PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr000385.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family Dof
Protein Properties Length: 379aa    MW: 41134.1 Da    PI: 8.4002
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr000385.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.61.6e-3970130262
       zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                  +++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  Pbr000385.1  70 QQQALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 130
                  57899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.1E-3372128IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52574128IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-2675128IPR003851Zinc finger, Dof-type
PROSITE patternPS01361076112IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MLSNCDHEKM ALLISSTTNE WPQLQQDIQI DDIHHQKGLN NNNNNVRSSS TSSPANRIME  60
KPGQEQLQLQ QQALKCPRCD SSNTKFCYYN NYSLSQPRHF CKACKRYWTR GGTLRNVPVG  120
GGCRKNKRVK RPGSTSSTSS AMDGGATSSS SSVPSTTAAA NNNTNPNSHP SHIDQINPLF  180
YGLSSNPFMD TASGFDLHQL NHHAQLGLGF SSSSGTNMMS SDNYRNRFNP ASSSSLPSNY  240
SSMFSTSPST TVPTMASVLA SKFINGGAFK DIQARGPHQQ NQYFQSLLPF EDLQIAAGNN  300
GEAGGAVKDV KVEDHNGQNR LQWNNNNGSS HVNGNMNCQN QISEQMGLSD PTPYWNSSTL  360
GSNWHDPANL GSSVSSLI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009342005.10.0PREDICTED: dof zinc finger protein DOF1.4-like
TrEMBLM5X0R01e-158M5X0R0_PRUPE; Uncharacterized protein
STRINGVIT_10s0003g00040.t013e-79(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.24e-34Dof family protein